Histidine acid phytases (HAPhy) are widely distributed enzymes among bacteria, fungi, plants, and some animal tissues. They have a significant role as an animal feed enzyme and in the solubilization of insoluble phosphates and minerals present in the form of phytic acid complex. A set of 50 reference protein sequences representing HAPhy were retrieved from NCBI protein database and characterized for various biochemical properties, multiple sequence alignment (MSA), homology search, phylogenetic analysis, motifs, and superfamily search. MSA using MEGA5 revealed the presence of conserved sequences at N-terminal “RHGXRXP” and C-terminal “HD.” Phylogenetic tree analysis indicates the presence of three clusters representing different HAPhy, that is, PhyA, PhyB, and AppA. Analysis of 10 commonly distributed motifs in the sequences indicates the presence of signature sequence for each class. Motif 1 “SPFCDLFTHEEWIQYDYLQSLGKYYGYGAGNPLGPAQGIGF” was present in 38 protein sequences representing clusters 1 (PhyA) and 2 (PhyB). Cluster 3 (AppA) contains motif 9 “KKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDP” as a signature sequence. All sequences belong to histidine acid phosphatase family as resulted from superfamily search. No conserved sequence representing 3- or 6-phytase could be identified using multiple sequence alignment. This in silico analysis might contribute in the classification and future genetic engineering of this most diverse class of phytase. 1. Introduction Phytate (myo-inositol 1,2,3,4,5,6-hexakisphosphate; IP6) is the major storage form of phosphorus (P), representing approximately 80% of P in soil [1], 65–80% of total P in grains [2], and up to 80% of P in manures from monogastric animals [3]. Phytate exists primarily as metal phytate complex with nutritionally important cations, that is, Ca2+, Fe2+, and Zn2+ [4]. Phytases (IP6 phosphohydrolase) are a class of phosphatases which catalyses hydrolysis of phytate to inositol phosphates, inorganic phosphorus, and myo-inositol [5], also lowers down affinity of phytate to associated minerals and proteins [6], and thus increases bioavailability of P, minerals, and proteins for growth and development of plants and animals [7–9]. Phytases are widely distributed among plants [10, 11], certain animal tissues, and microbial cells [12–15]. To date, four classes of phytases have been characterized in terrestrial organisms: histidine acid phytase (HAPhy), cysteine phytase (CPhy), purple acid phosphatase (PAP), and -propeller phytase (BPPhy) [16, 17]. HAPhys are the most studied and diverse class of
References
[1]
B. L. Turner, M. J. Papházy, P. M. Haygarth, and I. D. McKelvie, “Inositol phosphates in the environment,” Philosophical Transactions of the Royal Society B, vol. 357, no. 1420, pp. 449–469, 2002.
[2]
J. N. A. Lott, I. Ockenden, V. Raboy, and G. D. Batten, “Phytic acid and phosphorus in crop seeds and fruits: a global estimate,” Seed Science Research, vol. 10, no. 1, pp. 11–33, 2000.
[3]
G. M. Barnett, “Phosphorus forms in animal manure,” Bioresource Technology, vol. 49, no. 2, pp. 139–147, 1994.
[4]
K. Asada, K. Tanaka, and Z. Kasai, “Formation of phytic acid in cereal grains,” Annals of the New York Academy of Sciences, vol. 165, no. 2, pp. 801–814, 1969.
[5]
M. Wyss, R. Brugger, A. Kronenberger et al., “Biochemical characterization of fungal phytases (myo-inositol hexakisphosphate phosphohydrolases): catalytic properties,” Applied and Environmental Microbiology, vol. 65, no. 2, pp. 367–373, 1999.
[6]
D. B. Mitchell, K. Vogel, B. J. Weimann, L. Pasamontes, and A. P. G. M. Van Loon, “The phytase subfamily of histidine acid phosphatases: isolation of genes for two novel phytases from the fungi Aspergillus terreus and Myceliophthora thermophila,” Microbiology, vol. 143, no. 1, pp. 245–252, 1997.
[7]
N. R. Augspurger, D. M. Webel, X. G. Lei, and D. H. Baker, “Efficacy of an E. coli phytase expressed in yeast for releasing phytate-bound phosphorus in young chicks and pigs,” Journal of Animal Science, vol. 81, no. 2, pp. 474–483, 2003.
[8]
O. A. Olukosi, A. J. Cowieson, and O. Adeola, “Age-related influence of a cocktail of xylanase, amylase, and protease or phytase individually or in combination in broilers,” Poultry Science, vol. 86, no. 1, pp. 77–86, 2007.
[9]
S. M. Rutherfurd, T. K. Chung, and P. J. Moughan, “The effect of microbial phytase on ileal phosphorus and amino acid digestibility in the broiler chicken,” British Poultry Science, vol. 43, no. 4, pp. 598–606, 2002.
[10]
D. M. Gibson and A. H. J. Ullah, “Purification and characterization of phytase from cotyledons of germinating soybean seeds,” Archives of Biochemistry and Biophysics, vol. 260, no. 2, pp. 503–513, 1988.
[11]
C. E. Hegeman and E. A. Grabau, “A novel phytase with sequence similarity to purple acid phosphatases is expressed in cotyledons of germinating soybean seedlings,” Plant Physiology, vol. 126, no. 4, pp. 1598–1608, 2001.
[12]
R. Greiner, M. L. Alminger, and N. G. Carlsson, “Stereospecificity of myo-inositol hexakisphosphate dephosphorylation by a phytate-degrading enzyme of baker's yeast,” Journal of Agricultural and Food Chemistry, vol. 49, no. 5, pp. 2228–2233, 2001.
[13]
Y. O. Kim, J. K. Lee, H. K. Kim, J. H. Yu, and T. K. Oh, “Cloning of the thermostable phytase gene (phy) from Bacillus sp. DS11 and its overexpression in Escherichia coli,” FEMS Microbiology Letters, vol. 162, no. 1, pp. 185–191, 1998.
[14]
Y. H. Tseng, T. J. Fang, and S. M. Tseng, “Isolation and characterization of a novel phytase from Penicillium simplicissimum,” Folia Microbiologica, vol. 45, no. 2, pp. 121–127, 2000.
[15]
A. H. Ullah and D. M. Gibson, “Extracellular phytase (E.C. 3.1.3.8) from Aspergillus ficuum NRRL 3135: purification and characterization,” Preparative Biochemistry, vol. 17, no. 1, pp. 63–91, 1987.
[16]
E. J. Mullaney and A. H. J. Ullah, “The term phytase comprises several different classes of enzymes,” Biochemical and Biophysical Research Communications, vol. 312, no. 1, pp. 179–184, 2003.
[17]
H. M. Chu, R. T. Guo, T. W. Lin et al., “Structures of Selenomonas ruminantium phytase in complex with persulfated phytate: DSP phytase fold and mechanism for sequential substrate hydrolysis,” Structure, vol. 12, no. 11, pp. 2015–2024, 2004.
[18]
S. Afinah, A. M. Yazid, M. H. Anis Shobirin, and M. Shuhaimi, “Phytase: application in food industry,” International Food Research Journal, vol. 17, no. 1, pp. 13–21, 2010.
[19]
U. Konietzny and R. Greiner, “Bacterial phytase: potential application, in vivo function and regulation of its synthesis,” Brazilian Journal of Microbiology, vol. 35, no. 1-2, pp. 11–18, 2004.
[20]
L. Cao, W. Wang, C. Yang et al., “Application of microbial phytase in fish feed,” Enzyme and Microbial Technology, vol. 40, no. 4, pp. 497–507, 2007.
[21]
X. G. Lei and J. M. Porres, “Phytase enzymology, applications, and biotechnology,” Biotechnology Letters, vol. 25, no. 21, pp. 1787–1794, 2003.
[22]
B. C. Oh, W. C. Choi, S. Park, Y. O. Kim, and T. K. Oh, “Biochemical properties and substrate specificities of alkaline and histidine acid phytases,” Applied Microbiology and Biotechnology, vol. 63, no. 4, pp. 362–372, 2004.
[23]
M. Lehmann, C. Loch, A. Middendorf et al., “The consensus concept for thermostability engineering of proteins: further proof of concept,” Protein Engineering, vol. 15, no. 5, pp. 403–411, 2002.
[24]
R. L. Van Etten, R. Davidson, P. E. Stevis, H. MacArthur, and D. L. Moore, “Covalent structure, disulfide bonding, and identification of reactive surface and active site residues of human prostatic acid phosphatase,” Journal of Biological Chemistry, vol. 266, no. 4, pp. 2313–2319, 1991.
[25]
E. J. Mullaney and A. H. J. Ullah, “Conservation of cysteine residues in fungal histidine acid phytases,” Biochemical and Biophysical Research Communications, vol. 328, no. 2, pp. 404–408, 2005.
[26]
A. K. Dubey, S. Yadav, M. Kumar, V. K. Singh, B. K. Sarangi, and D. Yadav, “In silico characterization of pectate lyase protein sequences from different source organisms,” Enzyme Research, vol. 2010, Article ID 950230, 14 pages, 2010.
[27]
N. Malviya, M. Srivastava, S. K. Diwakar, and S. K. Mishra, “Insights to sequence information of polyphenol oxidase enzyme from different source organisms,” Applied Biochemistry and Biotechnology, vol. 165, pp. 397–405, 2011.
[28]
V. K. Morya, S. Yadav, E. K. Kim, and D. Yadav, “In silico characterization of alkaline proteases from different species of Aspergillus,” Applied Biochemistry and Biotechnology, vol. 166, pp. 243–257, 2012.
[29]
J. Kyte and R. F. Doolittle, “A simple method for displaying the hydropathic character of a protein,” Journal of Molecular Biology, vol. 157, no. 1, pp. 105–132, 1982.
[30]
B. Bjellqvist, G. J. Hughes, C. Pasquali et al., “The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences,” Electrophoresis, vol. 14, no. 10, pp. 1023–1031, 1993.
[31]
N. Saitou and M. Nei, “The neighbor-joining method: a new method for reconstructing phylogenetic trees,” Molecular Biology and Evolution, vol. 4, no. 4, pp. 406–425, 1987.
[32]
E. Zuckerkandl and L. Pauling, “Evolutionary divergence and convergence in proteins,” in Evolving Genes and Proteins, pp. 97–166, 1965.
[33]
K. Tamura, D. Peterson, N. Peterson, G. Stecher, M. Nei, and S. Kumar, “MEGA5: molecular evolutionary genetics analysis using maximum likelihood, evolutionary distance, and maximum parsimony methods,” in Molecular Biology and Evolution, vol. 28, pp. 2731–2739, 2011.
[34]
T. L. Bailey and C. Elkan, “Fitting a mixture model by expectation maximization to discover motifs in biopolymers,” in Proceedings of the 2nd International Conference on Intelligent Systems for Molecular Biology, pp. 28–36, AAAI Press, Menlo Park, Calif, USA, 1994.
[35]
E. J. Mullaney and A. H. J. Ullah, “Phytases: attributes, catalytic mechanisms and applications,” in Inositol Phosphates: Linking Agriculture and the Environment, pp. 97–110, CAB International, Oxfordshire, UK, 2007.
[36]
Y. Lindqvist, G. Schneider, and P. Vihko, “Crystal structures of rat acid phosphatase complexed with the transition-state analogs vanadate and molybdate. Implications for the reaction mechanism,” European Journal of Biochemistry, vol. 221, no. 1, pp. 139–142, 1994.
[37]
K. S. Porvari, A. M. Herrala, R. M. Kurkela et al., “Site-directed mutagenesis of prostatic acid phosphatase. Catalytically important aspartic acid 258, substrate specificity, and oligomerization,” Journal of Biological Chemistry, vol. 269, no. 36, pp. 22642–22646, 1994.
[38]
A. Ikai, “Thermostability and aliphatic index of globular proteins,” Journal of Biochemistry, vol. 88, no. 6, pp. 1895–1898, 1980.
[39]
N. D. Rawlings, F. R. Morton, and A. J. Barrett, “MEROPS: the peptidase database,” Nucleic Acids Research, vol. 34, pp. D270–D272, 2006.
[40]
K. Guruprasad, B. V. B. Reddy, and M. W. Pandit, “Correlation between stability of a protein and its dipeptide composition: a novel approach for predicting in vivo stability of a protein from its primary sequence,” Protein Engineering, vol. 4, no. 2, pp. 155–161, 1990.
[41]
S. Rogers, R. Wells, and M. Rechsteiner, “Amino acid sequences common to rapidly degraded proteins: the PEST hypothesis,” Science, vol. 234, no. 4774, pp. 364–368, 1986.
[42]
J. Gough, “The SUPERFAMILY database in structural genomics,” Acta Crystallographica Section D, vol. 58, no. 11, pp. 1897–1900, 2002.