全部 标题 作者
关键词 摘要

OALib Journal期刊
ISSN: 2333-9721
费用:99美元

查看量下载量

相关文章

更多...
PLOS ONE  2013 

Identification of a Novel Nuclear Localization Signal Sequence in Chlamydia trachomatis-Secreted Hypothetical Protein CT311

DOI: 10.1371/journal.pone.0064529

Full-Text   Cite this paper   Add to My Lib

Abstract:

We previously reported that Chlamydia trachomatis hypothetical protein CT311 was secreted out of chlamydial inclusion and into host cell cytosol. We now found that CT311 further entered host cell nucleus at the late stage of infection and continued to accumulate in the nucleus of C. trachomatis-infected cells. When CT311 was expressed via a transgene in mammalian cells, CT311 protein was exclusively detected in the nucleus, suggesting that CT311 by itself is sufficient for nuclear targeting. However, preexisting nuclear CT311 did not affect subsequent chlamydial infection. Using deletion constructs, we mapped a nuclear localization signal sequence of CT311 to residues 21 to 63 (21AVEGKPLSRAAQLRERRKDLHVSGKPSPRYALKKRALEAK?KNK63). This sequence was sufficient for targeting a heterologous protein into mammalian cell nucleus and it contains two independent clusters of basic residues (34RERRK38 and 53KKRALEAKKNK63 respectively). Deletion or alanine substitution of the basic residues in either cluster led to loss of nuclear targeting activity, suggesting that both clusters are critical for the nuclear targeting function. These observations have demonstrated that the hypothetical protein CT311 possesses a novel nuclear localization signal sequence with dual modules of basic residues for targeting host cell nucleus during Chlamydia trachomatis infection.

References

[1]  Brunham RC, Rey-Ladino J (2005) Immunology of Chlamydia infection: implications for a Chlamydia trachomatis vaccine. Nat Rev Immunol 5: 149–161.
[2]  Cheng W, Shivshankar P, Li Z, Chen L, Yeh IT, et al. (2008) Caspase-1 contributes to Chlamydia trachomatis-induced upper urogenital tract inflammatory pathologies without affecting the course of infection. Infect Immun 76: 515–522.
[3]  Cheng W, Shivshankar P, Zhong Y, Chen D, Li Z, et al. (2008) Intracellular interleukin-1alpha mediates interleukin-8 production induced by Chlamydia trachomatis infection via a mechanism independent of type I interleukin-1 receptor. Infect Immun 76: 942–951.
[4]  Stephenson J, Hopwood J, Babiker A, Copas A, Vickers M (2003) Recent pilot studies of chlamydia screening. Sex Transm Infect 79: 352.
[5]  Chen C, Chen D, Sharma J, Cheng W, Zhong Y, et al. (2006) The hypothetical protein CT813 is localized in the Chlamydia trachomatis inclusion membrane and is immunogenic in women urogenitally infected with C. trachomatis. Infect Immun 74: 4826–4840.
[6]  Gong S, Lei L, Chang X, Belland R, Zhong G (2011) Chlamydia trachomatis secretion of hypothetical protein CT622 into host cell cytoplasm via a secretion pathway that can be inhibited by the type III secretion system inhibitor compound 1. Microbiology 157: 1134–1144.
[7]  Hackstadt T, Scidmore-Carlson MA, Shaw EI, Fischer ER (1999) The Chlamydia trachomatis IncA protein is required for homotypic vesicle fusion. Cell Microbiol 1: 119–130.
[8]  Heuer D, Rejman Lipinski A, Machuy N, Karlas A, Wehrens A, et al. (2009) Chlamydia causes fragmentation of the Golgi compartment to ensure reproduction. Nature 457: 731–735.
[9]  Hobolt-Pedersen AS, Christiansen G, Timmerman E, Gevaert K, Birkelund S (2009) Identification of Chlamydia trachomatis CT621, a protein delivered through the type III secretion system to the host cell cytoplasm and nucleus. FEMS Immunol Med Microbiol 57: 46–58.
[10]  Lad SP, Yang G, Scott DA, Wang G, Nair P, et al. (2007) Chlamydial CT441 is a PDZ domain-containing tail-specific protease that interferes with the NF-kappaB pathway of immune response. J Bacteriol 189: 6619–6625.
[11]  Lei L, Qi M, Budrys N, Schenken R, Zhong G (2011) Localization of Chlamydia trachomatis hypothetical protein CT311 in host cell cytoplasm. Microb Pathog 51: 101–109.
[12]  Li Z, Chen D, Zhong Y, Wang S, Zhong G (2008) The chlamydial plasmid-encoded protein pgp3 is secreted into the cytosol of Chlamydia-infected cells. Infect Immun 76: 3415–3428.
[13]  Qi M, Lei L, Gong S, Liu Q, DeLisa MP, et al. (2011) Chlamydia trachomatis secretion of an immunodominant hypothetical protein (CT795) into host cell cytoplasm. J Bacteriol 193: 2498–2509.
[14]  Zhong G, Fan P, Ji H, Dong F, Huang Y (2001) Identification of a chlamydial protease-like activity factor responsible for the degradation of host transcription factors. J Exp Med 193: 935–942.
[15]  Moon DC, Choi CH, Lee SM, Lee JH, Kim SI, et al. (2012) Nuclear translocation of Acinetobacter baumannii transposase induces DNA methylation of CpG regions in the promoters of E-cadherin gene. PLoS One 7: e38974.
[16]  Park J, Kim KJ, Choi KS, Grab DJ, Dumler JS (2004) Anaplasma phagocytophilum AnkA binds to granulocyte DNA and nuclear proteins. Cell Microbiol 6: 743–751.
[17]  Zhu B, Nethery KA, Kuriakose JA, Wakeel A, Zhang X, et al. (2009) Nuclear translocated Ehrlichia chaffeensis ankyrin protein interacts with a specific adenine-rich motif of host promoter and intronic Alu elements. Infect Immun 77: 4243–4255.
[18]  Pennini ME, Perrinet S, Dautry-Varsat A, Subtil A (2010) Histone methylation by NUE, a novel nuclear effector of the intracellular pathogen Chlamydia trachomatis. PLoS Pathog 6: e1000995.
[19]  Guo H, Ding Q, Lin F, Pan W, Lin J, et al. (2009) Characterization of the nuclear and nucleolar localization signals of bovine herpesvirus-1 infected cell protein 27. Virus Res 145: 312–320.
[20]  Kalderon D, Roberts BL, Richardson WD, Smith AE (1984) A short amino acid sequence able to specify nuclear location. Cell 39: 499–509.
[21]  Robbins J, Dilworth SM, Laskey RA, Dingwall C (1991) Two interdependent basic domains in nucleoplasmin nuclear targeting sequence: identification of a class of bipartite nuclear targeting sequence. Cell 64: 615–623.
[22]  Guo ZJ, Wang DX, Yao Q, Chen KP, Zhang CX (2010) Identification of a novel functional nuclear localization signal in the protein encoded by open reading frame 47 of Bombyx mori nucleopolyhedrovirus. Arch Virol 155: 1943–1950.
[23]  Izaurralde E, Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4: 351–364.
[24]  Greene W, Xiao Y, Huang Y, McClarty G, Zhong G (2004) Chlamydia-infected cells continue to undergo mitosis and resist induction of apoptosis. Infect Immun 72: 451–460.
[25]  Greene W, Zhong G (2003) Inhibition of host cell cytokinesis by Chlamydia trachomatis infection. J Infect 47: 45–51.
[26]  Fan T, Lu H, Hu H, Shi L, McClarty GA, et al. (1998) Inhibition of apoptosis in chlamydia-infected cells: blockade of mitochondrial cytochrome c release and caspase activation. J Exp Med 187: 487–496.
[27]  Bogdanove AJ, Schornack S, Lahaye T (2010) TAL effectors: finding plant genes for disease and defense. Curr Opin Plant Biol 13: 394–401.
[28]  Lebreton A, Lakisic G, Job V, Fritsch L, Tham TN, et al. (2011) A bacterial protein targets the BAHD1 chromatin complex to stimulate type III interferon response. Science 331: 1319–1321.
[29]  Zurawski DV, Mumy KL, Faherty CS, McCormick BA, Maurelli AT (2009) Shigella flexneri type III secretion system effectors OspB and OspF target the nucleus to downregulate the host inflammatory response via interactions with retinoblastoma protein. Mol Microbiol 71: 350–368.
[30]  Jinadasa RN, Bloom SE, Weiss RS, Duhamel GE (2011) Cytolethal distending toxin: a conserved bacterial genotoxin that blocks cell cycle progression, leading to apoptosis of a broad range of mammalian cell lineages. Microbiology 157: 1851–1875.

Full-Text

Contact Us

service@oalib.com

QQ:3279437679

WhatsApp +8615387084133